PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G106900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 203aa    MW: 22413.8 Da    PI: 8.883
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G106900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.68.5e-4474150278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cqve+C adl+eak+yhrrhkvCe+h+kap+v+vsg++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  Manes.03G106900.1.p  74 CQVERCGADLTEAKRYHRRHKVCEIHAKAPAVIVSGIRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSA 150
                          **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-3666135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.42871148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-4072152IPR004333Transcription factor, SBP-box
PfamPF031102.2E-3374147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MDAKAHEGKR SSRERVMFKD DCIVDEDLDD DMEEEDGSGG FVDDEKKKGV GMVHGKRGNS  60
GGGGSSGGSS SPSCQVERCG ADLTEAKRYH RRHKVCEIHA KAPAVIVSGI RQRFCQQCSR  120
FHELSEFDEA KRSCRRRLAG HNERRRKSSA ESYGEGSSGR KGLFGGQAQL KESQFRQADE  180
RGKYHITIPG NNSATYKRSQ IL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-4164147184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533086.13e-86PREDICTED: squamosa promoter-binding-like protein 3
TrEMBLB9T4B74e-86B9T4B7_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0001s40870.12e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-45squamosa promoter binding protein-like 4